PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 334aa    MW: 38677.5 Da    PI: 6.4276
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922867.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-52141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yL+kkv+ ++l++  +i+evd+yk++PwdLp+k+  + kewyfF++rd+ky++g+r+nra+ +gyWkatg dk+v+ k
  XP_010922867.1  14 LPPGFRFHPTDEELVVHYLCKKVACQRLPV-PIIAEVDLYKYDPWDLPEKALFGLKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATGADKPVTPK 107
                     79****************************.88***************8777899**************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++  g+kk Lvfy+g+ap+g+ktdW+mheyrl
  XP_010922867.1 108 gSSRPLGIKKALVFYSGKAPRGVKTDWIMHEYRL 141
                     67778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-5910158IPR003441NAC domain
PROSITE profilePS5100558.23414198IPR003441NAC domain
PfamPF023659.3E-2715141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGSRRRDAEA ELNLPPGFRF HPTDEELVVH YLCKKVACQR LPVPIIAEVD LYKYDPWDLP  60
EKALFGLKEW YFFTPRDRKY PNGSRPNRAA GRGYWKATGA DKPVTPKGSS RPLGIKKALV  120
FYSGKAPRGV KTDWIMHEYR LADTNRAANK KGSLRVCHRQ SEIHKFFVSW LLYEYRSDEK  180
IHEFMQLDDW VLCRLYNKKN TWEKMQQQKE AASFGETMDS VDDTGSDSFR TPESDIDNDV  240
MFPDFDDMAQ VGAHPPQAFN GMQGVRVNNI TGYQPAIEQR PKEENDWFTD LNLDDFHSTC  300
MAFGSTPALD MSDHDYYYSN LPQLRSNQSD LLPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-9212041174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922867.10.0PREDICTED: NAC domain-containing protein 68-like isoform X1
SwissprotQ52QH41e-115NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLQ2XQF70.0Q2XQF7_ELAGV; NAC protein 1 splice variant 1
STRINGGSMUA_Achr7P21780_0011e-151(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-83NAC domain containing protein 32